HORDB

ID: hor005656
Uniprot ID: P01298
Protein name: Pancreatic icosapeptide
Gene name: PPY
Organism: Homo sapiens (Human)
Family: NPY family
Source: Human
Expression: NA
Disease: Diseases associated with PPY include Non-Functioning Pancreatic Endocrine Tumor and Auditory System Cancer.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0009306 protein secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: HKEDTLAFSEWGSPHAAVPR
Length: 20(69-88)
Propeptide: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
Signal peptide: MAAARLCLSLLLLSTCVALLLQPLLGAQG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.; The physiological role for the icosapeptide has not yet been elucidated.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005656_AF2.pdb

hor005656_ESM.pdb

Mass:	257452	Formula:	C100H147N29O30
Absent amino acids:	CIMNQY	Common amino acids:	A
pI:	6.5	Basic residues:	4
Polar residues:	4	Hydrophobic residues:	7
Hydrophobicity:	-79.5	Boman Index:	-4086
Half-Life / Aliphatic Index:	3.5 hour	Aliphatic Index:	49
Instability Index:	4821.5	Extinction Coefficient cystines:	5500
Absorbance 280nm:	289.47

PubMed ID: 6094571
Title: Structure of a Precursor to Human Pancreatic Polypeptide
PubMed ID: 6366786
Title: Human pancreatic icosapeptide: isolation, sequence, and immunocytochemical localization of the COOH-terminal fragment of the pancreatic polypeptide precursor.