General Information

  • ID:  hor005656
  • Uniprot ID:  P01298
  • Protein name:  Pancreatic icosapeptide
  • Gene name:  PPY
  • Organism:  Homo sapiens (Human)
  • Family:  NPY family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with PPY include Non-Functioning Pancreatic Endocrine Tumor and Auditory System Cancer.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0009306 protein secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  HKEDTLAFSEWGSPHAAVPR
  • Length:  20(69-88)
  • Propeptide:  MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
  • Signal peptide:  MAAARLCLSLLLLSTCVALLLQPLLGAQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.; The physiological role for the icosapeptide has not yet been elucidated.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01298-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005656_AF2.pdbhor005656_ESM.pdb

Physical Information

Mass: 257452 Formula: C100H147N29O30
Absent amino acids: CIMNQY Common amino acids: A
pI: 6.5 Basic residues: 4
Polar residues: 4 Hydrophobic residues: 7
Hydrophobicity: -79.5 Boman Index: -4086
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 49
Instability Index: 4821.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 289.47

Literature

  • PubMed ID:  6094571
  • Title:  Structure of a Precursor to Human Pancreatic Polypeptide
  • PubMed ID:  6366786
  • Title:  Human pancreatic icosapeptide: isolation, sequence, and immunocytochemical localization of the COOH-terminal fragment of the pancreatic polypeptide precursor.